5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning

(45 customer reviews)

$11.70

CHINA
CHINA
CHINA
Clear
SKU: 3256806843486109 Category:
Description




5 in 1 Earphone Case Cleaning Pen with Spray Port Portable Phone Screen Cleaning Tools Multifunctional Accessories for Airpods 3

Q6 5 in 1 Cleaner Kit Multifunctional Earbuds Cleaning Pen Dust Removal Brush Bluetooth-compatible Earphones Case Mobile Phone Cleaning Tools with Spray Port Grey
Feature:
Multifunctional 5-in-1 integrated design: with flocked brush head, flocked sponge stick, cleaning cloth, metal nib, cleaner spout (without cleaning spray)
Metal nib: It can clean the stubborn dust and stains in the gap of the mobile phone or earphone without hurting the charging port
High-density flocking brush head: three-dimensional high-density flocking, easy to clean earphone/phone sound hole and other parts
Flocking sponge stick: Delicate and soft flocking sponge cleans the charging compartment of the earphone box, decontamination does not leave any residue
With screen cleaner spray port: You can use your own cleaning spray to clean the stains deeply, press down to spray the cleaner
Washable Fiber Flannel: Wipe up quickly and stay as clean as new. Specially contains sterilization factor, no alcohol and no irritation, remove dangerous grease, fingerprints, etc.
Sliding design: push-pull button design, save space, can be retracted when not in use, easy to carry
Mini and compact: 3.8*7.5*1.8CM size, clever design, compatible with a variety of devices
Wide compatibility: Can clean a variety of devices, such as headphones, mobile phones, tablets, laptops, TVs and other digital devices

Specification:
Name: Q6 5 in 1 Multifunctional Cleaning Kit
Material: ABS + metal + sponge + microfiber cloth
Color: grey
Function: Deep clean a variety of digital devices
Weight (without detergent): 40g
Size: 3.8*7.5*1.8CM
Packing size: 9.5*5.5*2CM

Note:
Does not contain cleaning spray.
Due to the different monitor and light effect, the actual color of the item might be slightly different from the color showed on the pictures. Thank you!
Please allow 1-2cm measuring deviation due to manual measurement. 



1x Cleaning Kit 






Reviews (45)

45 reviews for 5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning

  1. 5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    +1
    W***s
    June 30, 2025
    Highly recommended! I love it
    Helpful? 0 0
    AliExpress Shopper
    June 18, 2025
    Great product, just as described
    Helpful? 0 0
    H***a
    June 7, 2025
    A good cleaner and as it should
    Helpful? 0 0
    5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    C***i
    June 7, 2025
    This cleaning tool is really helpful, i luv the spray and how it cleans my phone screen really fast. The delivery is also really fast as well
    Helpful? 0 0
    C***a
    June 4, 2025
    Same as the image, fulfills its function.
    Helpful? 0 0
    5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    M***S
    June 1, 2025
    Nice
    Helpful? 0 0
    M***ć
    May 22, 2025
    Very good quality!
    Helpful? 0 0
    AliExpress Shopper
    May 22, 2025
    Crazy product
    Helpful? 0 0
    A***o
    May 20, 2025
    It is very practical and very easy to use.
    Helpful? 0 0
    I***r
    May 13, 2025
    Very good for ear buds cleaning.
    It even has a container for water.
    Helpful? 0 0
    AliExpress Shopper
    May 10, 2025
    Complies with everything perfectly
    Helpful? 0 0
    D***n
    April 17, 2025
    Helpful? 0 0
    5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    L***a
    April 14, 2025
    Okay
    Helpful? 0 0
    I***r
    April 9, 2025
    Decent, simple product. Came with a water sprayer to clean the airpods (and the case) works with most earphones very well. Very affordable and effecti...More
    Decent, simple product. Came with a water sprayer to clean the airpods (and the case) works with most earphones very well. Very affordable and effective product to improve sound quality too.
    Helpful? 0 0
    AliExpress Shopper
    April 8, 2025
    Helpful? 0 0
    I***e
    March 30, 2025
    Helpful? 0 0
    AliExpress Shopper
    March 29, 2025
    Works as stated
    Helpful? 0 0
    A***n
    March 28, 2025
    Works well
    Helpful? 0 0
    Y***r
    March 20, 2025
    Helpful? 0 0
    h***i
    March 19, 2025
    Helpful? 0 0
    o***o
    March 18, 2025
    Useful thing
    Helpful? 0 0
    P***k
    March 17, 2025
    Helpful? 0 0
    T***V
    March 17, 2025
    Helpful? 0 0
    g***s
    March 15, 2025
    Thank you for the fast delivery.
    Helpful? 0 0
    P***n
    March 15, 2025
    Kgrkuyemyengsnyengsgnwnfqgmsngangdngengenywmys fab rent
    Helpful? 0 0
    R***i
    March 13, 2025
    It arrived on time and in good condition and is very functional.
    Helpful? 0 0
    V***n
    March 4, 2025
    Helpful? 0 0
    m***i
    February 28, 2025
    Helpful? 0 0
    b***r
    February 28, 2025
    Helpful? 0 0
    K***h
    February 28, 2025
    Because of this product I came back to hear my iPhone
    Helpful? 0 0
    v***v
    February 23, 2025
    Helpful? 0 0
    r***i
    February 23, 2025
    excellent
    Helpful? 0 0
    К***н
    February 20, 2025
    Very well packed and quickly passed
    Helpful? 0 0
    d***r
    February 17, 2025
    Excellent
    Helpful? 0 0
    R***v
    February 13, 2025
    Helpful? 0 0
    Z***l
    February 13, 2025
    it's really good
    Helpful? 0 0
    AliExpress Shopper
    February 12, 2025
    Super!
    Helpful? 0 0
    5 in 1 Phone Screen Cleaning Tools with Spray Port Portable phone Cleaning photo review
    AliExpress Shopper
    February 6, 2025
    Really handy tool. It gets into all the little crevices I wouldn’t normally be able to clean. I highly recommend this tool.
    Helpful? 0 0
    W***s
    February 2, 2025
    Helpful? 0 0
    A***z
    January 28, 2025
    Helpful? 0 0
    AliExpress Shopper
    January 26, 2025
    Very satisfying
    Helpful? 0 0
    o***i
    January 23, 2025
    Helpful? 0 0
    A***s
    January 23, 2025
    Helpful? 0 0
    a***i
    January 23, 2025
    Helpful? 0 0
    AliExpress Shopper
    January 23, 2025
    Correct
    Helpful? 0 0
Add a review

Your email address will not be published. Required fields are marked *